Madshrimps Forum Madness

Madshrimps Forum Madness (http://www.madshrimps.be/vbulletin/index.php)
-   Site & Forum Feedback - Folding@Home (http://www.madshrimps.be/vbulletin/forumdisplay.php?f=5)
-   -   funny console thingy? (http://www.madshrimps.be/vbulletin/showthread.php?t=1159)

Magnum_ 7th January 2003 23:34

funny console thingy?
 
my f@h thingy is doin' some weird stuff lately :


[January 7 21:48:04] Working on Unit 02
+ Working ...
[21:48:04] Genome@Home2 Core Version 2.02 (Sept 5, 2002)
[21:48:04]
[21:48:04] Proj: work/wudata_02
[21:48:04] Finding work files
[21:48:04] sizeof(CORE_PACKET_HDR) = 512
[21:48:04] Checking frame files
[21:48:04] - Couldn't open work/wudata_02.chk
[21:48:04] Starting from initial work packet
[21:48:04]
[21:48:04] Updating shared core-client information
[21:48:04] - Writing "work/wudata_02.key": (overwrite)successful.
[21:48:04] Key file to update shared file: work/wudata_02.key
[21:48:04] keyfile: 0 30 200 15 2 1 0
[21:48:04] Protein: 1tst/pdb1tst.xyz
[21:48:04] - Frames Completed: 0, Remaining: 6000
[21:48:04] - Dynamic steps required: 1200000
[21:48:04]
[21:48:05] Printed current.prm
[21:48:05] Writing local files:
[21:48:05] - Writing "work/wudata_02.key": (overwrite)successful.
[21:48:05] - Writing "work/wudata_02.xyz": (overwrite)successful.
[21:48:05] - Writing "work/wudata_02.prm": (overwrite)successful.
[21:48:05] [SPA] project name: work/wudata_02.
[21:48:05] [SPA] 1 0
[21:48:05] [SPA] Initializing protein design algorithm
[21:48:05] [SPA] seed = 0
[21:48:05] [SPA] Initialization complete
[21:48:05] [SPA] Writing current.pdb, chainlength = 30
[21:48:05] [SPA] Writing current.xyz
[21:48:05] [SPA] Filtering . . .
[21:48:05] [Filter] 30 positions to filter
[21:48:05] [Filter] 30 positions to filter
[21:48:05] [Filter] 1 filtered
[21:48:05] [Filter] 2 filtered
[21:48:06] [Filter] 3 filtered
[21:48:06] [Filter] 4 filtered
[21:48:11] [Filter] 5 filtered
[21:48:11] [Filter] 6 filtered
[21:48:11] [Filter] 7 filtered
[21:48:11] [Filter] 8 filtered
[21:48:12] [Filter] 9 filtered
[21:48:12] [Filter] 10 filtered
[21:48:12] [Filter] 11 filtered
[21:48:12] [Filter] 12 filtered
[21:48:12] [Filter] 13 filtered
[21:48:13] [Filter] 14 filtered
[21:48:13] [Filter] 15 filtered
[21:48:13] [Filter] 16 filtered
[21:48:13] [Filter] 17 filtered
[21:48:13] [Filter] 18 filtered
[21:48:15] [Filter] 19 filtered
[21:48:15] [Filter] 20 filtered
[21:48:16] [Filter] 21 filtered
[21:48:16] [Filter] 22 filtered
[21:48:18] [Filter] 23 filtered
[21:48:18] [Filter] 24 filtered
[21:48:18] [Filter] 25 filtered
[21:48:18] [Filter] 26 filtered
[21:48:18] [Filter] 27 filtered
[21:48:19] [Filter] 28 filtered
[21:48:19] [Filter] 29 filtered
[21:48:19] [SPA] Filter complete
[21:48:19] Iterations: 0 of 6000
[21:48:20] Finished
[21:48:55] [SPA] Energy_Lookup
[21:48:56] [SPA] rotamer wheel done
[21:48:56] [SPA] seed: 14893390
[21:48:56] [SPA] Designing protein sequence 1 of 30
[21:49:41] [SPA] 10.0 %
[21:50:18] [SPA] 20.0 %
[21:50:50] [SPA] 30.0 %
[21:51:22] [SPA] 40.0 %
[21:51:53] [SPA] 50.0 %
[21:52:24] [SPA] 60.0 %
[21:52:55] [SPA] 70.0 %
[21:53:27] [SPA] 80.0 %
[21:54:00] [SPA] 90.0 %
[21:54:32] [SPA] 100.0 %
[21:54:32] [SPA] Sequence 1 completed:
[21:54:32] TYTRMNSYRREAGSGTPTFTPGEPHKVSGS
[21:54:32] Iterations: 200 of 6000
[21:54:33] Finished
[21:54:33] [SPA] seed: 29786780



and so on...

wtf? never seen that stuff before, on none of my folding stations...

jmke 7th January 2003 23:37

Genome@Home2 Core Version 2.02 (Sept 5, 2002)


GNOME Work Unit

worth... 0.78 points :)

set advanced options in the console, chose FAH :)

stronken 7th January 2003 23:38

same here

Magnum_ 7th January 2003 23:39

ah, tnx for the info

[size=0.1]tnx for editing, was wasting valuable database space :p [/size]

jmke 7th January 2003 23:48

Quote:

Originally posted by Magnum_
[size=0.1]tnx for editing, was wasting valuable database space :p [/size]
saving my scrollwheel actually ;p


All times are GMT +1. The time now is 06:42.

Powered by vBulletin® - Copyright ©2000 - 2022, Jelsoft Enterprises Ltd.
Content Relevant URLs by vBSEO